PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01079.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 268aa    MW: 29873.4 Da    PI: 5.8135
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01079.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.92.7e-19651147
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                             +g+W++eEde+l   v+++G+++W++I++ ++ gR++k+c++rw + 
  Rsa1.0_01079.1_g00003.1  6 KGPWSQEEDEQLRLMVEKHGPRNWSAISKSIP-GRSGKSCRLRWCNQ 51
                             79******************************.***********985 PP

2Myb_DNA-binding53.46.1e-1760102347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              ++++eEde +v a +++G++ W+tIar ++ gRt++ +k++w++ 
  Rsa1.0_01079.1_g00003.1  60 PFSPEEDETIVSARAKFGNK-WATIARLLN-GRTDNAVKNHWNST 102
                              89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.76156IPR017930Myb domain
SuperFamilySSF466892.84E-31399IPR009057Homeodomain-like
SMARTSM007172.6E-17554IPR001005SANT/Myb domain
PfamPF002496.8E-19651IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-25759IPR009057Homeodomain-like
CDDcd001675.74E-16850No hitNo description
SMARTSM007173.4E-1457105IPR001005SANT/Myb domain
PROSITE profilePS5129418.55558107IPR017930Myb domain
CDDcd001671.19E-1060103No hitNo description
PfamPF002493.7E-1460102IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-2260107IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0010200Biological Processresponse to chitin
GO:0048527Biological Processlateral root development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MADRVKGPWS QEEDEQLRLM VEKHGPRNWS AISKSIPGRS GKSCRLRWCN QLSPEVEHRP  60
FSPEEDETIV SARAKFGNKW ATIARLLNGR TDNAVKNHWN STLKRKWLDG NLTTEEEGRD  120
PAKKRRSMSS ESVVPPPVVD TGLYMSPESP NSDSSTVPAQ VFKPMPEVSP EEEEDPATAL  180
SLSLSLPGGD VSQESSQSSL LVPRFESQMR INVEERGEAR RGEFMRVVHE MVKAEVRSYM  240
AEMQRNNGGG FVVGGGGFYD SGITPKVE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C6e-3851063104C-Myb DNA-Binding Domain
1msf_C6e-3851063104C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1103125KRKWLDGNLTTEEEGRDPAKKRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00400DAPTransfer from AT3G50060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667431e-146KC966743.1 Brassica napus MYB transcription factor 77 (MYB77.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001302828.11e-139transcription factor MYB44-like
SwissprotQ9FDW14e-91MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A078H1F71e-149A0A078H1F7_BRANA; BnaAnng03830D protein
STRINGBra036048.1-P1e-133(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM135981527
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.11e-101myb domain protein 77